PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g086440.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 363aa    MW: 38946.2 Da    PI: 9.5429
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g086440.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.21.6e-3784143362
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         e+++kcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalr vPvGgg+r+nk+ss
  Sopim10g086440.0.1  84 EATQKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRSS 143
                         56789****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1014471.62E-54555No hitNo description
ProDomPD0074789.0E-3267136IPR003851Zinc finger, Dof-type
PfamPF027019.1E-3286141IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.99487141IPR003851Zinc finger, Dof-type
PROSITE patternPS01361089125IPR003851Zinc finger, Dof-type
SuperFamilySSF1014471.62E-5251256No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MVFSSISAYL DPSNWQQQVG YSIPNPQLPS GLSQPTPPRP LASTPPPPPP PPPPPQPHHV  60
GGGGSIRPGS MADRARLANI PMSEATQKCP RCESTNTKFC YFNNYSLSQP RHFCKTCRRY  120
WTRGGALRSV PVGGGCRRNK RSSTSNSSTS AKSSNNNTKS QGSSQTTNSG STSNNNSSPS  180
SAASLLGLMN PPIHPLRFMS PLGPLTDQHF TPNEMNYTSI SSPSPAPIVM GTNENMNFQL  240
GMGSNLEQWR LHQQLVNQFP YNLYGGLDSS PASGSGSASA SGLYPFHQAH YDASGGGVIS  300
QIRPKVSNPM LTQLALMKME DDQDHVASMP RQFLGNENWT SNANWNELSA SFSSSSTSNN  360
VL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2331230.0AC233123.5 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-13b20 map 10, complete sequence.
GenBankAC2402030.0AC240203.2 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-27f6 map 10, complete sequence.
GenBankAC2547810.0AC254781.4 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone sle-8a7 map 10, complete sequence.
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249836.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLK4D4760.0K4D476_SOLLC; Uncharacterized protein
STRINGSolyc10g086440.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.17e-43DNA binding with one finger 2.4